PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009620990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 280aa    MW: 32111.5 Da    PI: 6.4206
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009620990.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.6e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l++ +   G  +W++ ++  g+ R++k+c++rw +yl
   XP_009620990.1 14 KGPWSAEEDKKLINFILINGQCCWRSLPKVAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.83.9e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d++ qlG++ W++Ia++++ gRt++++k++w+++
   XP_009620990.1  71 SEYEEKMVIDLHSQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-19563IPR009057Homeodomain-like
PROSITE profilePS5129412.933961IPR017930Myb domain
SuperFamilySSF466893.74E-2611108IPR009057Homeodomain-like
SMARTSM007172.1E-111363IPR001005SANT/Myb domain
PfamPF002498.7E-131461IPR001005SANT/Myb domain
CDDcd001673.06E-81661No hitNo description
PROSITE profilePS5129425.43462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2464117IPR009057Homeodomain-like
SMARTSM007176.3E-1466114IPR001005SANT/Myb domain
PfamPF002497.1E-1471111IPR001005SANT/Myb domain
CDDcd001671.80E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRKPCCDKD GVKKGPWSAE EDKKLINFIL INGQCCWRSL PKVAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHSQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPITHRSIT VDQPNIEQPT KNQPIIQQEK QTTMPISPAH VVPEIIDILD HNKEMVETPV  180
LSTITEIKLE DDDNNNKKNT GTSFCTDEVP VIKPHEILFH SESTTSTFSS SSSPSSIILE  240
DMQFDFNWAD DFSRTLDYLL NDDIDMNNVI SQDWSKVLEV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620990.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-81ODO1_PETHY; Protein ODORANT1
TrEMBLK4BPV11e-108K4BPV1_SOLLC; Uncharacterized protein
STRINGSolyc04g014470.2.11e-108(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.14e-88myb domain protein 20